SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060SPG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060SPG3
Domain Number 1 Region: 385-427,456-505,534-563
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.41e-27
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 
Domain Number 2 Region: 189-318
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000153
Family DEP domain 0.024
Further Details:      
 
Domain Number 3 Region: 21-132
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000293
Family Archaeal DNA-binding protein 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060SPG3
Sequence length 623
Comment (tr|A0A060SPG3|A0A060SPG3_PYCCI) Uncharacterized protein {ECO:0000313|EMBL:CDO74129.1} KW=Complete proteome; Reference proteome OX=5643 OS=cinnabarina). GN=BN946_scf185043.g179 OC=Agaricomycetes; Polyporales; Polyporaceae; Trametes.
Sequence
MMKTTKRGRPFLKDTLDLFATLIVSLQLTTNRQYFKSFPNSFTTDDAARNLASLKFSQSN
RGPDPREPSRIVTTTTTTTFSMTRDMAKAMCQQFMDARLIENAADPGSNLFKERGVYVLT
PKGLHVLERFMSKNGINGDHLAHVFSSQPICMKLLHLERRSVDDEIIVSHSAITALFRRF
VGRQPNYPPENIETMDAFQKYHERSKGVSLMDVTEKGVGKAAVVHKHCFRVTALEWLCDF
TSVIGREEAAEMAAQXXXXXXXXSLVSDKRKNNDSAIIFTVRGAAGGANSSISQHGEFRC
TAKAIYKVTDEGRRLARWDLPEGARASPNSSAANVSNNARSSEDRSLDTATAEGANSSDA
KIHRRISMTEKLHASYDAAEKKGQKESNTDRLKFIMEEPQLRALFREFLRSNFCEENLSF
YLDVQDFKKSFSTTSSAIAANTPPPKAGQKATPGQLAMERHHEALIHKAFVIYNTYLAPS
SQSELNIDHGLRNELSAYLSEVMQNLTGKTFQGHVDLEQANNFNATQLQTMIRLYERIQT
HVFRLMATDSVPKFIKTPRFLALKVKLVEEDDGPLADFPLMNSSASTPSVPPGLASGEEE
VGGAYVTVSQRAAVQERAAGEHR
Download sequence
Identical sequences A0A060SPG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]