SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060SW34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060SW34
Domain Number 1 Region: 92-246
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-29
Family Spectrin repeat 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060SW34
Sequence length 264
Comment (tr|A0A060SW34|A0A060SW34_9DYTI) Alpha spectrin {ECO:0000313|EMBL:CDO78500.1} OX=1491598 OS=Exocelina desii. GN=aspec OC=Dytiscidae; Copelatinae; Exocelina.
Sequence
LQFRRSRNRTKIKSFKLSWAELKQLAATRGQKLXESLTYQXFLAKVEEEEAWISEKQQLL
SVEDYGDTMAAVQGLLKKHDVFETDFTAHGERCKDICEYGTKLVADGNHHADNINQRCQQ
LQTKLDNLSSLASRRKAKLKDNSAYLXFMWKADVVESWIADKETHVRSEEXGRDLSTVQT
LLTKQDTFDAGLHAFEHEGIQNITSLKDHLIESNHDQSEAIKKRHSDVIDRWQKLLGASD
ARKQQLLRMQEQFRQIEELYLTFA
Download sequence
Identical sequences A0A060SW34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]