SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060T1F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060T1F3
Domain Number 1 Region: 58-212
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-30
Family Spectrin repeat 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060T1F3
Sequence length 230
Comment (tr|A0A060T1F3|A0A060T1F3_9DYTI) Alpha spectrin {ECO:0000313|EMBL:CDO78483.1} OX=1491538 OS=Exocelina sp. MB1313. GN=aspec OC=Dytiscidae; Copelatinae; Exocelina.
Sequence
ESLTYQQFLAKVEEEEAWISXKQQLLSVEDYGDTMAAVQGLLKKHDVFETDFTAHGERCK
DICEYGTKLVADGNHHADNINQRCQQLQTKLDNLSSLASRRKAKLXDNSAYLQFMWKADV
VESWIADKETHVRSEEFGRDLSTVQTLLTKQDTFDAGLHAFEHEGIXNITSLKDHLIESN
HDQSEAIKKRHXDVIDRWQKLLGASDARKQQLLRMQEQFXQIEXLYLTFA
Download sequence
Identical sequences A0A060T1F3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]