SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060T2C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060T2C9
Domain Number 1 Region: 14-128
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.83e-19
Family Regulator of G-protein signaling, RGS 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060T2C9
Sequence length 212
Comment (tr|A0A060T2C9|A0A060T2C9_BLAAD) ARAD1A00902p {ECO:0000313|EMBL:CDP33062.1} OX=409370 OS=Blastobotrys adeninivorans (Yeast) (Arxula adeninivorans). GN=GNLVRS02_ARAD1A00902g OC=Saccharomycetes; Saccharomycetales; Trichomonascaceae; Blastobotrys.
Sequence
MERMSISCRLPLLEDIVANLVAPPYTLSAFREFVDHNHCSEVLDFILDVRKYKSTYHTMT
ADMAYNVSASIINCYVRSNAPKEINLACHTRDELLQSADQGKVDPKDLEVAYSQALDLLK
DNVYIPFVAMMRRSGSASYTACELPISPALTPKSVSSQSSASLSEYTTHRSTHDGVPEKV
TAVTVCSEVGPCSAASKKPIWKSTFKWLKPGR
Download sequence
Identical sequences A0A060T2C9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]