SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060TFG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060TFG4
Domain Number 1 Region: 20-121
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.27e-33
Family Chaperone J-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 146-227
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 7.72e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.00046
Further Details:      
 
Domain Number 3 Region: 130-164,229-267
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000068
Family HSP40/DnaJ peptide-binding domain 0.0066
Further Details:      
 
Domain Number 4 Region: 276-366
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000131
Family HSP40/DnaJ peptide-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060TFG4
Sequence length 377
Comment (tr|A0A060TFG4|A0A060TFG4_BLAAD) ARAD1D15180p {ECO:0000313|EMBL:CDP37602.1} OX=409370 OS=Blastobotrys adeninivorans (Yeast) (Arxula adeninivorans). GN=GNLVRS02_ARAD1D15180g OC=Saccharomycetes; Saccharomycetales; Trichomonascaceae; Blastobotrys.
Sequence
MLRIVWICVVVLLIQLAIAEDYYKILGVGRDASEKDIKKAYRRLSREYHPDKNPGNDEAA
QKFVEIAGAYEVLSDKEQRAIYDRYGEDGLKNQGRGGHHGDMKNAFDMFRSFFGGGHPFG
AGGRRVQRGPDVQTTLECDLKTMYEGGTIDFSLNLQGVCDECDGTGSADGKEHTCDVCGG
QGIRIVRHQLAPGMFQQIQTPCDKCGGKGKVISHPCKVCGGAKVVREERQYHVYVEPGSA
QKFEHRIPGEADMSPDWETGDLLVHVVEARRGNMGYRRKGRNLFRTEVLSMKEALKGGWS
RSIPFIDGSSKVNLTRNSGVPVSNGEVERIKGWGMPPEPEHDHEHDHHHSKHDKYGDLYI
DYVVIPAGGKKDLHDEL
Download sequence
Identical sequences A0A060TFG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]