SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060VCY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060VCY2
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.36e-82
Family MHC antigen-recognition domain 0.00000000643
Further Details:      
 
Domain Number 2 Region: 184-275
Classification Level Classification E-value
Superfamily Immunoglobulin 4.3e-31
Family C1 set domains (antibody constant domain-like) 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060VCY2
Sequence length 341
Comment (tr|A0A060VCY2|A0A060VCY2_HUMAN) MHC class I antigen {ECO:0000313|EMBL:CDQ51650.1} OX=9606 OS=Homo sapiens (Human). GN=HLA-C OC=Catarrhini; Hominidae; Homo.
Sequence
SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWD
RETQKYKRQAQTDRVSLRNLRGYYNQSEARSHIIQRMYGCDVGPDGRLLRGYDQYAYDGK
DYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQS
AEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTF
QKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLG
AVVAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Download sequence
Identical sequences A0A060VCY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]