SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060VM48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060VM48
Domain Number 1 Region: 301-351
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000183
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 124-190
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 71-129
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000706
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060VM48
Sequence length 414
Comment (tr|A0A060VM48|A0A060VM48_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ55973.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00064154001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MAVFRPKINVGNLWFLAVIRDLRHVVDTLMTEVRSGKYTAKSSVWIGSLLTVLSTAVILQ
SVCVCDCEITCSWTTGNWGPCSQSCGGGQQTRHIQCLRKVTYQREEVVAHSLCPVIAPAQ
VLPCHNQACPPEWSSGVWSQCSKSCGRGMRKRGVFCRSTDPGAKAVVVPDSMCKPHLKPK
AQETCVLRRCPKNDRLQWFTTPWGEVVTHGDRQTDAHAVQTHPHILLYNLCSTSCGPGVR
RRELRCGERDSQGGYTDFPMRRCRNLPKPSGDLQQTCSRGPCPEPRLVAPGRTASAVVLG
WYSSPWQQCSVSCGGGVQSRSIQCLRQGRPAAGCLNHQRPVTSRACNTHFCPAPPAHVPA
PAPTFKGEQSCVDFFSWCHLVPQHSVCNHKFYGQQCCKSCNGKKPIRLEDSLFP
Download sequence
Identical sequences A0A060VM48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]