SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060VUP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060VUP7
Domain Number 1 Region: 377-433
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000654
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 2 Region: 488-543
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000654
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 432-488
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000732
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 330-374
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000902
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 241-288
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.00086
Further Details:      
 
Domain Number 6 Region: 546-599
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000275
Family Hormone receptor domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060VUP7
Sequence length 1554
Comment (tr|A0A060VUP7|A0A060VUP7_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ56689.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00064318001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MAWPPPRSGPLVALVALLFLGLTSSIPSGPASDTCATLEQSRFFGLFSSTANLPSTPCSW
TLQNPDPRRYTVYMKITKPSDSCLPRQVKTFQFDSFIETSRTYLGMESFDEVVRLCDAST
SVTYLESSKQFLQLRKVAPRHGLEIVEGESSGEFKAEFLVVGKRNPSMPACQKLCQWLEN
CLSTSTHPNPCGIMNTPCQCWETPVRKPGGCYRGGVYLEQCIPTPRDNGRDIVRDTEIIK
GWNGWGRWSECSMECGGGVQVRSRACHPEDSVCEGVVEEGRACNPQPCIGQVRARSQALA
SIVGLKRENADVPSTGVVAPQTVDAAAVADEWSPWSVCSVSCGEGWQARSRFCVTSSYST
QCTGPLRENRPCNNTMVCPVDGAWDEWSPWSLCSSTCGRGYRDRTRTCKQPQNGGEPCKG
PIKQTKFCNIAVCPVDGAWNEWSGWTTCSASCSNGTKQRTRECNGPSYGGSECRGDWRET
NNCFLKDCPVDGRWLSWSSWGSCSKTCGGGSQQRQRMCEGPYFGGEPCPGERGELRRCNE
KRCPEPHEICQEETDGDVVWKRTPAGDMAAVTCPTDSTGLTLRRCTLGAVGLAYWENPTY
IKCISKNYQDISTLAQDGVDKAKKGLMADGISEVISRLRATSDEGTKYSGDLLSIMDVLR
NTTEIYKGAGYSLSNADVENYAQTISNLLKEEHHDKWEEAQLMGAYVKEFLQLVEDFVDM
IGMQMKDFQDIYEVTENLVLSIHKRPTAMTTDFTFPVKGWRGMMDWVRTSEEKITVSRDA
LSIDQSEGTTAFVTGIILYRNLSSILSFQSNSSVLNSKVVTVVVKPTPGLLSTPVEIEFP
HLHNDTINETCISWDESETSSLLGSWSARSCRAVAVDSFRTKCVCDRLSTFAILARLNPD
MNMDKNLLPSVTLIVGCGVSSLTLLLLIIIYVSVWKYIRSERSVILINFCLSIICSNALI
LVGQTQARNKVVCGVVAALLHFFFLSSFCWVLTEAWQSYMAVTGRLRNRIIRKRFLCLGW
GLPALVVAVSVGFTKAKGYGTVNYCWLSLEGGLLYSFVGPAAAVVLVNMVIGILVFNKLV
SKDGITDVKLKERAGASLWSSCVILPLLALTWMSAVLAMTDRRSALFQILFAVFDSLEGF
IIVMVHCILRREASTTFSPRKVVDRKDDGNGDSGSSLQNSHHTQLMSDFEKDADSNRPDM
PSIILLSVHSLTYLPRPSSPFQEKMPLPPQLPLPMSSNFHTLPSHTTKAHMQAVPEYSSH
TLTLKREKTRLHGGMDPSSCGKPVYVCEGELFQQLDANLARGQAEGSCPDGSGYLLLPNT
TSTLRKAKEDPSKYNISVEQLPQTRLVHLSGPFAEPQAAFGLKTLPSDRVSVSYSERDSP
VQNIHNMSSESHITHSSLGDTFDSMNSMMSKSETISTLSMSSLERQKSRYAELDFEKIMH
TRKRHQNMFQDLNRKLHHAEKQDRESPASDSKSVRWSVSSGGSDKTNHSDKQLPQVERPW
EGVQRTQHSPPAWVRKDLEPLAASPLHMQQVEWEKAGATIPMVSQDIIDLQTEV
Download sequence
Identical sequences A0A060VUP7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]