SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060VZB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060VZB3
Domain Number 1 Region: 226-386
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.12e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000206
Further Details:      
 
Domain Number 2 Region: 59-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000755
Further Details:      
 
Domain Number 3 Region: 23-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000224
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060VZB3
Sequence length 387
Comment (tr|A0A060VZB3|A0A060VZB3_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ60368.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00081673001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MKRQFIIQFKHVHISRFQFGAYVNDCVGQPCKNGGSCRDLNGDFNCRCPSPYVGKHCQLR
CISLLGMEGGGIAESQISASSVHYGILGLQRWGPELARLHNKGLVNAWTSASHDRNPWIE
INMQRKMRFTGIVTQGASRMGSAEFIKAFKVASSLDGRTYTVYRLDGQKKDNVFVGNVDN
DSTKTNLFDPPIIGQYFRIIPVVCRKACTLRMELVGCELNVYSNTAGCSEPMGMKSRLLS
DRQISASSVHRTWGIEAFTWQSYYARLDKQGKTNAWTAATTNRSEWLQVDLESPKRITGI
ITQGAKDFGAVQFVSAFKVAYSDDGQSWSIVKDDVTSTDKIFPGNSDNNVHKKNVFEPPF
YARLVRILPWAWHERITLRMELLGCDE
Download sequence
Identical sequences A0A060VZB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]