SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060W0K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060W0K9
Domain Number 1 Region: 119-258
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.59e-36
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.049
Further Details:      
 
Domain Number 2 Region: 1-131
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.31e-32
Family Poly(A) polymerase, PAP, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060W0K9
Sequence length 297
Comment (tr|A0A060W0K9|A0A060W0K9_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ60652.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00082237001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MRREVVERIERVIKDLWPTADVQVFGSFSTGLYLPTSDIDLVVFGKFREGDSLPLWRLEE
ALRKHKVVEENSVKVLDKATVPIIKLTDSLTEVKVDISFNMKNAVKAAALIKDYKKKYPV
LPYLVLVLKQFLLQRDMNEVFTGGISSYCLFLIAVSFLQLHSREDACSPNANTGVLLIEF
FELYGRHFNYLKTGIRIKDGGCYLSKDEVQKSMLDGYRPSLLYIEDPLQPGNDVGRSSYG
AMQVKQVFDYAYMVLSHAVSPIAKYYPNNHSERYRAGLGLMGEGYCHIISSDGRNRR
Download sequence
Identical sequences A0A060W0K9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]