SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060W5I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060W5I7
Domain Number 1 Region: 293-505
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.54e-58
Family Reprolysin-like 0.00058
Further Details:      
 
Domain Number 2 Region: 586-643
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 3 Region: 878-934
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000116
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060W5I7
Sequence length 1020
Comment (tr|A0A060W5I7|A0A060W5I7_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ60529.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00081960001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MHMLFWGLGFLLFLPDFLNIVSSTGRSLLSSRKAKISEQLGAYEIVTPERVNEAGDNFPT
SVHFKRKKRSVEDSPDNSSDQWALPSIHYKISAFGQNYHLNLTLESGFIAPLYTVTVLGA
PIVNITDFTPEEETEEDTEYQHCFYKGHVNAQTENTAVISLCSGLLGTFRSPEGEYFVEP
LHSYNGELYEEEHTKPHIVYRKKASVNEAAVEDTACDTSGHKHRHKRNSDKVKRRPLSSS
SSSMLDDLDDLDGLSAGLTADPFSRTERESGRRPANDSSGDSGPHRRSKRFLSYPRFVEV
MVVADSKMVEHHGSNLQHYILTLMSIVSSIYKDPSIGNLINVVIVKLVIINNELDGPTIS
FNAQTTLKNFCIWQQRQNHQDENHHSHHDTAILITRYTVTPTTTQPFSSPGLAELGTVCD
PYRSCSISEDNGLSTAFTIAHELGHVFNMPHDDSNKCKEEGVKIQQHVMAPTLNYYTNPW
MWSKCSRKYITEFLDTGYGECLLDEPISRPYSLSQQLPGRIYNVNKQCELIFGPGTQVCP
YMVREWTTQISNGSKGMVTVCVCGWDSGKGMHCKHGQCIPKEHDATPVDGAWGGWSPFGS
CSRTCGGGIKIAVRECNQPVPKNGGKYCVGRRMKFRSCNSEPCSKQKKDFREEQCAAFDG
RHFNINGLPPNVRWVPKYSGIQMKDRCKLFCRVAGSTAYYQLRDRVIDGTPCGPDTNDIC
VQGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNMVRYGYNEVVRIPSGATNI
DVRQHSYSGKPEDDNYLAVSNSRGDFLLNGEFVVSMFKREIKVGNAVIEYSGSDHVIERI
NCTDRIEEEIIVQVLSVGNLYNPDVRYSYNIPIEDKPQQFVWDAYGPWQDCSRPCQGERK
RKILCSRESDRVVVSDQRCHGAARPAMVTEPCNAECEIRWHVARKSECTVPCGVGYRTLE
IYCAKLSRADGKTQKVDERYCSSQRKPDDKESCHGDCNPGGWEYSSWSEVRMPVIVLRDL
Download sequence
Identical sequences A0A060W5I7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]