SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060W7A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060W7A4
Domain Number 1 Region: 115-173
Classification Level Classification E-value
Superfamily L27 domain 1.73e-24
Family L27 domain 0.00025
Further Details:      
 
Domain Number 2 Region: 232-332
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-20
Family PDZ domain 0.0000469
Further Details:      
 
Domain Number 3 Region: 181-231
Classification Level Classification E-value
Superfamily L27 domain 0.000000001
Family L27 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060W7A4
Sequence length 355
Comment (tr|A0A060W7A4|A0A060W7A4_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ60440.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00081786001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MNGHMTESDGRGGVEANQEEPQQWHREMAVDCPGDLGARTLPVRRSAQLERIRQHQEDRR
RKEEEGRNRQELDLTASIRLKKLSQNPKVGIDNPTFDPIEGPGGPPGLPPNLGAPTLLEL
EELLMSLKQVQHCLSDGQSQEDVELVLQLVQKTDFQKAFNIHNAVAQHMNRPSPPFPHTD
RAQGLAHEVQSMVHNSQHTEGLELNTLLSSPHVQAVLLAHDCVAEQEMQLEPLTPDPCEA
LTQWGGETVKIVRMEKARDIPLGATVRNDMDSVVISRIVKGGAAERSGLLHEGDEVLEIN
GVEIRGKDVNEVFDILAEMHGTLTFILIPSSQNKPPPIKETVVSTDRTPVHQRLW
Download sequence
Identical sequences A0A060W7A4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]