SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WAC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WAC8
Domain Number 1 Region: 808-1036
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-61
Family DBL homology domain (DH-domain) 0.0000000135
Further Details:      
 
Domain Number 2 Region: 395-592
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.68e-58
Family Regulator of G-protein signaling, RGS 0.0000112
Further Details:      
 
Domain Number 3 Region: 1037-1172
Classification Level Classification E-value
Superfamily PH domain-like 3.21e-38
Family Pleckstrin-homology domain (PH domain) 0.00000703
Further Details:      
 
Domain Number 4 Region: 72-151
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-21
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060WAC8
Sequence length 1477
Comment (tr|A0A060WAC8|A0A060WAC8_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ62179.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00066670001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MFYLDFSLHSVFSYNFLSFYLSLFFPFCAGCCSVGCCVALPARLHSGGPDVLVQKSDCVL
VEGKPESCGLVQRCVIIQKDENGFGLTVSGDNPVFVQLVKEDGAAERAGVQTGDRIIKVN
GTLVTHSNHVEVVKLIKSGSYVALTVLGRPPGLPQIPLSESEAKLGFPGPQAGSSPVSSP
SAPGQPTGECPYSPHDRITSPLPIWEENNSVHSQKVDILQKMLSKEQQDLQAMKEEYSRN
PTPKLLKDIQEAKKHIPQLQWQLSKATGGAQDALQLGDGDDGSMVDMDHTPSSRGDSSND
LSWSSSTMSPVLRSFAPASPESLCQRDMLSYHSPKSTPRDSFNSCHSPDPEDTPDLDSLS
PSAVNSPSSRFVSQIIGAEDDYFDSDQEQVNGQCSCFQSMELLKSRPAHLAAFLHHVVSQ
FDPAPLLCYLFADLCKQTNSKETRRVFMDFHNFFIDRGANLKVAVPESISSDLVSLADKS
MPNRRRTELIPEEQNRQLVQMMQDTLLPDIQRNLEDFRSKRSMGLTLAEGELARLDTERV
RDRVALERERSCAENIITKIEDVLLTTQSTEEEKCTTMQYVILAYMKRLGVKVKEPRGLE
FKRVRLNFLPKIKKSVKTEKEGGEEKVKRTRFPSILGPPRRPSRVDPTSIGKAMDLNKPR
PQKQLSQPCLGAVEHLEAGRLTASQSSEGSELTHSSNTNATSPTNSTTNSHASDGGSRDS
EFVLTPNSAFLKLSEGLGDLDSLQYTPNTHFDYSLSPYSLDQLQEEDRESRILEGTPKSI
RRLDGLGSTEVQSEDDQGGTDSEHDPLNWQQLVGREVLAGLGAHEIKRQEVINELFYTER
AHLRMLKVLDNIFYQKLTREAILPPADIKNIFTNLGDIVQLHVLISEQMATIRKRNETSV
IDQIGDDLLSWFSGGEEEKIKQAVGTFCSNQPFALELIKSRQKKDSRFTSFMQEAESNRL
CRRLQLKDIIPVEMQRLTKYPLLLENIAKYTDDTMEKDKVKKAGDCCRKILNHVNQAVKE
SENKQRLEDYQRRLDLSSLKQTENPMITELKNLDLTKKKMIHEGPLSWKVNKDKTIELYT
LLLEDILVLLQKQDERLVLKCHSKNLSGTADTKHIFSPIIKLNAVLVRSVATDNKSFFVL
SMSDNGAQIYELMAQTVSEQRMWQRQITQRADAMKVKPHSGIHLPRTDVEIIAADVARLG
KDPDRISSGSSQSIDKECSAASGGVMQTSLPDAKSFLGLKPEEEEPSREEGLYEDPDLAD
RLPFRMAVDGFSESDGLGFSPSRADDALKTLSALKQVLVTQLMSQEDGERAGRSSSGGGR
LLRTTSLRTPVDSRARVAVQKGSGMCTQASHPEDPAQDLVSGDTGFFESPEDYAGYLVLE
GYGGSGESSTDDDLQATGKQLSASRGCGAGDSGISLRFSSASQAGSISSFSRQVLSHLRN
LQTNLNHLKEVEAKYHSLLRQRPARSSTDTDINKDKR
Download sequence
Identical sequences A0A060WAC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]