SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WGA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WGA6
Domain Number 1 Region: 61-192
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.58e-41
Family Regulator of G-protein signaling, RGS 0.00000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060WGA6
Sequence length 199
Comment (tr|A0A060WGA6|A0A060WGA6_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ66298.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00075056001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MRKRQQPHIEGPPQAPGHPRPNNCCMCWCGCCKCLWNEDRMEHSERACTKMDSIEATEEQ
QPTLDEVVAWARSFELVMRSSEGREIFREFLRSEYSEENLLFWLACEELKKETDPTAIDE
KARIIYEDYVSILSPKEVSLDSRVREGINLSLTEPSNLMYEEAQLQIYTLMHRDSYPRFL
NSSVYRDLLDSKRSSCLDT
Download sequence
Identical sequences A0A060WGA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]