SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WH09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WH09
Domain Number 1 Region: 268-391,422-468
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.35e-28
Family Nucleotide and nucleoside kinases 0.00031
Further Details:      
 
Domain Number 2 Region: 58-256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.95e-20
Family Nucleotide and nucleoside kinases 0.00084
Further Details:      
 
Domain Number 3 Region: 176-204
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000167
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0021
Further Details:      
 
Domain Number 4 Region: 13-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000654
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060WH09
Sequence length 477
Comment (tr|A0A060WH09|A0A060WH09_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ66442.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00075379001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MDETAKPLRIPPEMAIYAEKHEIFDLVQTLVTNLMVDKPEDPIQYLIVLLKRGSVQVPRV
MLLGPPASGKRTVARKLCEHTQVIHITDSNILKEDTDLTKKALQYKAKQQDIPGDLWIKL
IQQRLSKIDCVRRGWVLEGIPQTREEALSLQEAGVAPNHVVLLEAPDAVLIERSQGKRID
PVTGDVYHVTFIWPEDKEVVQRLERQKAVSEEQLVAQLMQHHREVHALRKTYRNCLKGID
ADQPHVDVFDQVLTYILSRHCSVAPHTPRVLLFGPPGSGKSLQAKLISQKYNIVNLCCGE
LLEAVSADATNMGELIKPYLESGQQVPDSMVLQILTERLSRLDCTTRGWVLHGFPRDLEQ
AEKLQESNFIPSRVFFLEMTDDVAIERVTLRSIDPVTGERYHSLYKPAPSPEVQTRLQFN
PKDSEAQLLQQLKEYWANASSLQDLYPEAVHINADQDPHTVFESLESRLVGRLQNDS
Download sequence
Identical sequences A0A060WH09
XP_021462376.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]