SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WHW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WHW9
Domain Number 1 Region: 1019-1076
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000471
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 566-620
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 367-406
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 4 Region: 98-152
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 5 Region: 898-952
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000085
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 6 Region: 698-753
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000222
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060WHW9
Sequence length 1108
Comment (tr|A0A060WHW9|A0A060WHW9_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ64809.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00071982001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MPCSLPISRPVRQAKRRKGKGEARERPGVKDPDTRELIQKKRTRNRLNRQESPFWDIQLG
YQSRTVSCAHRNGSTVGLSRCLPRELPLTVQSCILAKDCKLSEWADWGPCSKACLDPDPE
SPRGQRSRTRRVHQFSVGEGEDCPPLEETEPCDPQGDGVLPCATYTWRTTEWSDCRVDSL
LSQQDRRRSNQTGLCGGGLQNREVYCVQANVELLTYLNNLKDKDASRPVDSKLCGGPIPN
TSQLCHIPCPIECEVSPWGAWGPCTYENCDVQEGKKGFKLRKREISNEPTGGPGNCPHLV
EAVPCDEPSCWAWRLVRLDECIPDGELPCGPGTQIPQVQCVNSTGDMVDKELCGGAPAPE
PIACDVPCPKDCVLSDWTSWSSCSQTCSSKTIEGKQLRTRSVLAYNAGEVTAMVVAWITV
MEDERDRETQSERPTDRRERERERDTEREREVRKGQMFLGGGMCPNSSSLQEVRNCNEHA
CTVYHWQTGPWGPCTEDPSASALNTTTGPRSAAGPNTNGQGPCSQGMQTRKVICVRVNVG
QVPPKKCPESPRPGTVRPCRMPCKKDCIVTPFSDWSQCSPTCDAAGNIQKKKQSRKRVIL
QLPANGGQDCPEVLEEEKDCEAPKVCPGYRWKSHKWRRCQLVPWYIREDSPGAQDTCGPG
LQTRAVSCRQLDGAQADIGECLKFANTMPPISQRCQLPCQDDCQLTNWSKFSSCTADCVG
VRTRKRLLVGRSKKKDKCKNTQMYPLSETQYCPCDKYNAQPLGNWSDCILAGGDRVESLP
GTKVQGNIKECGQGYRYQAMVCYDQDNRLVETSRCNSHGGVELLGVCVCVCVQYVWVAEP
WSVWKVSNLDLKENCGEGVQTRKVRCMLNTIDGPSESVEDYLCDPEDMPLGTRGSRLPCP
EDCVLSDWSSWNRCSLPCSYNNSRKRTAYAIRSPGAGRQCPDTTEKEPCSLNLNCFHYFY
NITDWSTCQLSANAVCGNGIKTRMLDCVRSDSKSIDLKFCKELSLERKWQMNISCVVECP
VNCQLSDWSAWSECSHTCGLDGRMWRSRVVVQGSQGDGRPCPSQLEQWKPCPVRPCYRWQ
YSPWSECRVEVGYTTHSLILPGLSAEWR
Download sequence
Identical sequences A0A060WHW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]