SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WL44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WL44
Domain Number 1 Region: 38-241
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.69e-44
Family Reprolysin-like 0.0045
Further Details:      
 
Domain Number 2 Region: 332-388
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 9.02e-16
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 750-800
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000641
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 683-747
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 627-685
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000628
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060WL44
Sequence length 1086
Comment (tr|A0A060WL44|A0A060WL44_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ68213.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00036269001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MDLQALSRGVQHQHHNRIWNRTRQARARRQANEEHELFNIEVLLGVDSSVVHFHGREHIQ
KYLLTLMNIVNEIYQDRTLGAHINVVLVRIIMLCPAKSMSLIELGNPSQSLENICRWAFL
QQKEDRSDPEYHDHAIFLTRQEFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAH
ETGHVLGMEHDGPPGNECGDEVPMGSIMAPLVQAAFHRFHWSRCSQAELSKYLNSYDCLR
DDPFDHDWPALPQLPGIHYSMDEQCRFDFGAGYIMCTAYSTYDPCKQLWCSHPDNPFFCK
TKKGPPIDGTKCSPGMHCFKGYCIKLTPDILRQDGGWGTWSNFGSCSRTCGGGVRFRTRQ
CDNPTPANGGRTCYGNSYEFQLCNLEECSEPFADFREEQCKMWDPYFEYDNTKHHWLPYE
HPDPDERCQLYCKSKETGDVVAMNRMVHDGTRCSYKDPYSICVRGDCEHVGCDNQIASDT
QEDKCGICGGDNSSCKIIKGNFTRSVKKQGFLKILEIPRGARHLLIQEFKGTPHILAVKN
QATGHLFLNNEDEFPESRMVIEKGVEWEYHNDDDTETVQTTGPLGYAVLVMVRSHGDSKV
TLSYKYILHEKLQSSIESNLVQEDTAYFEWALKKWSQCSKPCGGGKQYTRFGCRRKSDGK
MVHRTYCVNIDNLRAISRDCNQKECSQPVWITGDWEECSSSCGKTGYQSRSVRCQQPLSG
GGQRSIHSKYCNDDRPEGRRPCNRQLCPAQWRVGPWSQCSVTCGNGSQERQVLCSTPDNS
VGLCMETKPITLRTCQLVPCTGDGKNVLIQWLSRSNPEFPVPKISSRQCKGDRSAFCRME
VLSRYCTNTGYRQMCCKSCTEGNFTTMGQNLTTGPWRYTTLPTPTNGTHSTTPTTTLRPK
PTAGIYSTDFAYVERDDYGEYTTKTDEISTTKTYRPTTTPGLTTRQPRRITTSLVTARST
KPPTTTTEETTVPRTSVITVTTAEPTTIPTSQDPSTLRTTNVPKVIVTLMPSTIAPHQTE
DKRENNSVDVPYRIVGVDNEVFQNHFVPRIRPPFRETTRNKRIQELLAEKQMQDLLLRRA
KRKPGP
Download sequence
Identical sequences A0A060WL44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]