SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WN63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WN63
Domain Number 1 Region: 25-100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000143
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 2 Region: 94-158
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000314
Family Fibronectin type I module 0.028
Further Details:      
 
Domain Number 3 Region: 220-263
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060WN63
Sequence length 372
Comment (tr|A0A060WN63|A0A060WN63_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ66514.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00075490001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MAKRIIFVFLTMAVTSQVGASCPAVCECPAMPLSCPPGVSAVADGCGCCKVCASQLNQDC
SPTMPCDHHKGLECNYGNDVTLAQGICRARKEGRTCEYNGRIYQNGENFRAGCKHQCTCI
DGVVGCSLLCANRLPPAIPSCPYPQLVRVPGQCCFTVDCHKGTWRLPPTKQHRQPTQPKP
HPDQYQPDNTLGNELVERGKGWENEQGYKHLPVWKNSLNCVVQTTDWSHCSRSCGMGVSS
RITNDNAQCKLDRETRLCTIRPCGDVAVPPKKGKKCSPTPKASEPMRLSYGECQSVRLYR
PNYCGVCTDGRCCSPRRTRTVPVTFVCPDGERFQRDAMFIQSCKCSKECGHLNEVALPPQ
HWMYGDTHKFID
Download sequence
Identical sequences A0A060WN63
XP_021423607.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]