SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WNZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WNZ8
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-23
Family Ankyrin repeat 0.00000352
Further Details:      
 
Domain Number 2 Region: 112-173
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-18
Family SH3-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060WNZ8
Sequence length 182
Comment (tr|A0A060WNZ8|A0A060WNZ8_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ69133.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00004353001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MQVENPSTANDEGITPLHNAVCAGRHHIVKFLLDFGVNVNAADSDGWTPLHCAASCNSVH
LCKLLVESGAAIFATTISDVETAADKCEEMEDGYTQCSQFLFGLQEKLGVMNKGSVYALW
DYEAQSSDELSFHEGDAITTLSCSDHAETEWWWARLHDKEGYVPRNLLGLYPRIKPRQRS
LA
Download sequence
Identical sequences A0A060WNZ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]