SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WT87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WT87
Domain Number 1 Region: 13-148
Classification Level Classification E-value
Superfamily SNARE-like 8.24e-29
Family Clathrin coat assembly domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060WT87
Sequence length 177
Comment (tr|A0A060WT87|A0A060WT87_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ68274.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00012301001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MDALSLEPTLYTVKAVLILDNDGERLYAKYYDETYPTVKEQKAFEKNIFNKTHRTDSEIA
LLEGLTVVYKSNIDLYFYVIGSSHENELMLMSVLNCLFDSLSQMLRKNVERRALLENMEG
LFLAVDEIVDGGVILESDPQQVVYRVALRGDDVPLTEQTVSQVLQSAKEQIKWSLLR
Download sequence
Identical sequences A0A060WT87 B5X5K5
XP_013988137.1.97760 XP_020344264.1.87700 XP_021424798.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]