SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WZJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WZJ9
Domain Number 1 Region: 39-169
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-47
Family Regulator of G-protein signaling, RGS 0.00000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060WZJ9
Sequence length 174
Comment (tr|A0A060WZJ9|A0A060WZJ9_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ72733.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00052413001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MKTRLACLSNKSDSYTDFTEFLPPAQDRTTRCLKLTKDEVIRWADSFDVLLSHKYGLAAF
RAFLKTEFSDENIEFWMACEEYKKIKTPAKLVTKANKIYNEFIDVKAPREVNIDFRTREV
TRQSLEEPTPSSLNEVQARVHSLMEKDSYPRFLRSKIYQDLLKTQYTHCQRNSV
Download sequence
Identical sequences A0A060WZJ9
XP_021460055.1.32639 XP_021460056.1.32639 XP_021460057.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]