SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WZX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WZX3
Domain Number 1 Region: 48-173
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.59e-42
Family Regulator of G-protein signaling, RGS 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060WZX3
Sequence length 202
Comment (tr|A0A060WZX3|A0A060WZX3_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ72731.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00052411001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MCKGLATLPATCLKSAKDIKHKIGFLLQKPEFPTDQKQVKEKTTAVKRVSPADVEKWKLS
FNNLMNCESGRTVFTAFLKSELSQENLEFWNACEEYKKSSPNKMAAKAKEIYEQYIEADS
PNEVNLDSATREETRQNLSIAGLSCFNDAQQKIFNLMEKDSYRRFLHSKLIQDLSLLSTT
TPLCALKKIGGKIVCSENRCGA
Download sequence
Identical sequences A0A060WZX3
XP_021460051.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]