SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060X008 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060X008
Domain Number 1 Region: 822-886
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000262
Family ATI-like 0.029
Further Details:      
 
Domain Number 2 Region: 876-942
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000356
Family VWC domain 0.053
Further Details:      
 
Domain Number 3 Region: 466-528
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000409
Family ATI-like 0.043
Further Details:      
 
Domain Number 4 Region: 979-1044
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000711
Family Fibronectin type I module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060X008
Sequence length 1177
Comment (tr|A0A060X008|A0A060X008_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ70180.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00020650001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MWTLLMSLLGLRVVMVMGHWCEHTVEERVDRIISPRLQREVDCSEVYQYNTQDWRLDVDR
MRHKHGGDDGIALYYKQLGRKAVCFLYKPAEMEPQRVNKTVRGCCEGWGGPRCSQGVGVR
GHCYSTWSCEDFPGVHNSSLMPMEQCCGSLWGLSWRNASDQTCLSCTYTLLADSQSSPLV
RGGHLGSARNPQGSATCLSWGGAHYRTFDRKHFHFQGDCTYVLASSTDGTWAVYISTVCN
GRGDCSKALRMMLGLDLVSVHLRNLTLNGLLVPQGEPLFQNGVSVHWLGDFVFVESGLGV
RVKFDMGYTVYLTVTTEHLATTRGLCGVYNNNADDDFTTMTGSVSEYAASFGNSWRVPDH
QTEAYSPTLHVSQGCNDAAELGHSCDVTGDSALRREAESVCHRLLESPFTQCHHRVDPAA
YVDTCLYLHCSLGTREREDATCDTLASYARECAQQHVIISWRSSGLCGRVCPRGQVFSDC
VSSCPPSCSSPQPPASGQCREECVGGCECPFGLYLHQGLCLRRDDCPCFHRRHTYQSGNT
IQQRCNTCVCRAGAWQCSGERCAAQCSLMGGLQVSTFDKKRYSLQGGDCGFTAIEDFVDR
KLVVSIRGGECVLGGGQGCLREMSVTALRTTVTITDTGAVTLNGQREALPVVTGDLVVRR
SSSSFLVVQTFGAQLLWHLDGPLALITLQPGFAHKIRGLCGTLTWNQHDDFTTPEGDVEN
TVSSFAAKFTTGDCLPPQDAPPDPCGSYSQRRQYAESVCSVIHSPVFQACHDVVEREPYL
RLCLTEVCGCGPQRPCQCTVLTAYSRHCAQEGVPVSWRNHTFCPLQCSGGQVYQECGRPC
GGSCTDLRQGWSCEQSNRSCVPGCQCPPGLAQDDKGQCVPVSMCPCMRGNKLYQPGSTVH
NNCNTCVCERGVWNCTKEVCPEVAQCPGSLVFSPRSCLLTCSSLDAPGQASPGPPTSPCQ
EPRAGCVCPQGTVLLGNHCVLPEQCPCHHNGRLYYNNDTITKDCNTCICKERRWHCGQSL
CAGTCVATGDPHYVTFDGRCFSFLGDCEYVLAQEVGGLFSVTAENVPCGSTGVTCTKSVS
LNVGNTAIHLLRGKAVTVNSMPVTLPKSYSGSGLTLERVGLFVSLSSRLGVTLLWDGGRE
YQDTHNPTHTHTHTYTYKHTHTHKHKHTQTHTRTSDH
Download sequence
Identical sequences A0A060X008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]