SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060X143 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060X143
Domain Number 1 Region: 266-596
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-60
Family Protein kinases, catalytic subunit 0.00000305
Further Details:      
 
Domain Number 2 Region: 114-263
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.77e-43
Family Regulator of G-protein signaling, RGS 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060X143
Sequence length 669
Comment (tr|A0A060X143|A0A060X143_ONCMY) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00038021001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MKLNSTRISQRSLKLNLHLQSTTPLSSRHFRSTFGAESGSERPYGESSGLKYSALGVGGW
GRTYYCQAGDEIGPVVPATQQNMELENIVANTVLLKAREGGGGNRKGKSKKWKQMLQFPH
ISLCEELRETTEKDYISLCERQPIGRTLFRQFCETRAELRRCVKFLDAVAEYEVSPDEKR
RECAQELLDKYFSPKSEDHIPELGEDMVGQFTERLEQEPCKELFNECTRLIHDYLSVAPF
ADYIDSMYYNRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLE
KKRIKKRKGESMALNEKQILEKLPTYLLLCVTLCIIYVQLKWEVYIHLERQRKTQNRELS
KFCKSVCQLLTRLMEEREVSYWDLKPENILLDDHGHIRISDLGLAVHVPEEETIKGRVGT
VGYMAPEVVKNERYTFSPDWWALGCLLYEMIEGQSPFQQRKKKIKREDVERLVRDVEEEY
SDKFSEDAKSLCKMLLAKEPSERLGCQGEGATEVKAHPIFRSINFKRLKAGRLKAPFTPD
PQAIYCKDVLDIEQFSTVKGVELEPKDDSFYCKVSTGSVSIPWQMELIVTCLMQYEDSHM
QTLDTIPQMIESECFQELNVFHTDGTVPPDLDWRGQPSPAPKQGLLQRLFGRQDCCGNCS
DSDEEPTRL
Download sequence
Identical sequences A0A060X143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]