SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060X1Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060X1Y3
Domain Number 1 Region: 966-1180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1e-105
Family Thrombospondin C-terminal domain 0.00000000373
Further Details:      
 
Domain Number 2 Region: 28-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-37
Family Laminin G-like module 0.000000385
Further Details:      
 
Domain Number 3 Region: 843-964
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.88e-36
Family TSP type-3 repeat 0.000000352
Further Details:      
 
Domain Number 4 Region: 446-495
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000034
Family TSP-1 type 1 repeat 0.0000716
Further Details:      
 
Domain Number 5 Region: 499-557
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000497
Family TSP-1 type 1 repeat 0.0000574
Further Details:      
 
Domain Number 6 Region: 775-845
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000262
Family TSP type-3 repeat 0.00026
Further Details:      
 
Domain Number 7 Region: 702-786
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000392
Family TSP type-3 repeat 0.0000887
Further Details:      
 
Domain Number 8 Region: 317-374
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000471
Family VWC domain 0.01
Further Details:      
 
Domain Number 9 Region: 390-439
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.00082
Further Details:      
 
Domain Number 10 Region: 558-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060X1Y3
Sequence length 1181
Comment (tr|A0A060X1Y3|A0A060X1Y3_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ71324.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00055129001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MKLTGVFLLLVLWNCEGSRVAESRDDNSVYDLFELVKVNKRHQGVTLVKGADPYSPAYKI
LNADLIPPVPEISFRDLIDSIQAERGFLLLVNFKQFKKTRGSLLTVERDDGSGPLFEIIS
NGKAQTLDVVYSTGNKQQVVSIEDADLATGHWKNITLFIQEDRAQLFVGCEEINISEMDV
PIQKVLTHEVADIARLRIGKGAVKDRFMGVLQNVRFVFGTTLEAILRNKGCQSSATLTDV
MTLDNPVNGSSPAIRTDYTGHKTKDIQQVCGFSCEDITSMFKELKGLGVIVKQLSNELNR
VNKESTLLMNQMNIHSGVCLHNGIVHKDKDEWTVDDCTECTCQNSATVCRKISCPLMPSC
ASKEAYKPDSLCCGNSSPIISLPPASDYAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRI
NSNCEGTSVQTRDCYPQECDKRFKQDGGWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQM
GGRDCQGQGRETEVCQESPCPINGGWGPWSLWDTCSVTCGGGLQTRQRLCNNPAPKYNGK
ECQGDTKTSQLCGKEDCPINGCLSNPCFAGAKCTSFDDGSWKCGSCPVGYTGNGINCKDI
DECNEVPDACFTLNAVHRCENTEPGYNCLACPPRYSGPQPFGRGVEQATAKKQVCTPRNP
CQDGTHDCNKNANCIYLGQFSDTMFRCECKPGYAGNGHICGDDTDLDGWPNKDLLCVENA
TYHCKKDNCPNLPNSGQEDHDKDGLGDACDHDDDNDGIPDDRDNCPMVYNPAQYDVDTDD
VGDRCDNCVHESNPDQVDTDNNGEGDACAIDIDGDGILNERDNCPYVYNVDQRDTDGDGV
GDHCDNCPLEHNPDQIDSDSDRVGDKCDNNQDIDEDGHQNNMDNCPYIPNANQADHDKDG
KGDACDHDDDNDGIPDDKDNCRLAFNPDQLDSDGDGRGDVCKDDFDQDNILDIYDVCPEN
FAISETDFRRFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFNAVDFS
GTFFINTDRDDDYAGFVFGYQSSSRFYVVMWKQITQTYWSHTPTRAQGYSGVSIKVVNST
TGPGEHLRNALWHTGDTAGQVRTLWHDPKNIGWKDYTAYRWHLVHRPKSGLIRVVMYEGK
RIMADSGNIYDKTYAGGRLGMYVFSQEMTYFSDLKYECRDS
Download sequence
Identical sequences A0A060X1Y3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]