SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060X5D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060X5D6
Domain Number 1 Region: 32-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000022
Family Growth factor receptor domain 0.005
Further Details:      
 
Domain Number 2 Region: 97-167
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000068
Family VWC domain 0.058
Further Details:      
 
Domain Number 3 Region: 228-272
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060X5D6
Sequence length 381
Comment (tr|A0A060X5D6|A0A060X5D6_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ74783.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00035805001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MLSLVSLRRTVSTLFVLLSSAAVMVESDCPAQCSCGPSPPLCPVGVSWVTDACGCCKVCA
RQFNQDCSPSQPCDHIKGLHCHLGAGGNPERGLCRAEAKGQSCEFSGRVYQHGEDFQPSC
QHQCSCMDGVVGCMPLCPHQVSLPDWRCSRPRLARPLGRCCAEWVCDDNNHISEDPEEPP
QVALPNPQPLPNHINNQLQEQPRYQASTGVTFREVVPLPRSQVLLSARCFPQTTDWTECS
TTCGMGISSRVTNNNADCQLVRETRLCQVRQCDLRLTPAIKRGKKCQRSVRPQEPISINF
AGCYTARHYRPRSCGSCVDRRCCTPSLTRTVRLRFHCPDGEGFTRNVMWIQRCSCKKSCH
IHGSPSRPSVSLHNDIHTFRH
Download sequence
Identical sequences A0A060X5D6
XP_021476878.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]