SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060XH07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060XH07
Domain Number 1 Region: 177-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-83
Family Protein kinases, catalytic subunit 0.000000999
Further Details:      
 
Domain Number 2 Region: 24-173
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.18e-30
Family Regulator of G-protein signaling, RGS 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060XH07
Sequence length 555
Comment (tr|A0A060XH07|A0A060XH07_ONCMY) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00046758001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MAANSALISAREGGGGKGRSWKWRRMLRFPHISQCMELGNTIARDYSSLCVKQPIGRQLF
CLFCQSKPELRHCNSLLDKMGEYEVQSDEDRKSFGMQIINRFLSRQSSECVQVVESYGKR
CRESLEVRHGRDIFIDCTDDLHEFLSGAPFLQYLQSMYFERFLQWKMVERQPVTKHTFRQ
YRMLGKGGFGEVWACQVRASGKMYACKKLEKTHMKKRRGEAMALNEKQILEKLNSRFVVS
LAYAYETKQSLCLVLSIMNGGDLRFHIYNIGPPGLEPARVRFYAAEVCCGLHHLHQRNIV
YRDLKPENILLDDNGHIRISDLGLAVKLSGGNLVRGRVGTLGYMAPEVIGHEYYGISPDW
WGLGCLVYEMTAGRSPFKRQGEQLTAKEMERRIQETEEVYRKTFSSETEDFCRSLLTKDP
RQRLGCRRCGVEGVKSHPFFSTINFRRLDAGVIEPPFKPNPRAVYCKDVQDIDEFSTVKG
VILERTDDDFYTKFNTGCVAIPWQTEMIEMGCFKELNVFGPQGSRPPDLDWGQNPAPEKP
KRRLLDRIFHKTHTC
Download sequence
Identical sequences A0A060XH07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]