SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060XMM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060XMM7
Domain Number 1 Region: 86-143
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 218-266
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000837
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 335-356
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 269-331
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000706
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060XMM7
Sequence length 363
Comment (tr|A0A060XMM7|A0A060XMM7_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ80833.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00058232001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MYPLSEIQYCPCNKYNAQPVGNWSDCILPEGGRVEGQPGMKIQGDIKECGQGYRYQAMVC
YDQDNRLVETSRCNSHGYIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREK
PYNGGRPCPKLDHVNQVYEVVPCLSDCGQYVWVAEPWSVWKVSNVDLKENCGEGVQTRKV
RCMQNTMDGPSDSVEDYLCDPEEMPLGARDSQLPCPEDCVLSDWGVWSRCSLPCNKISTR
ERTACLIRQPGEGKLCPNTTETEPCSLNSNCYHYSYNITDWSTCQLSERAVCGSGIKTRM
LDCVRSDGKSVDLKFCEELGLDRKWQMNASCVVECPVNCQLSDWSPWSECTQTCGLAGTS
PSF
Download sequence
Identical sequences A0A060XMM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]