SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060XR37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060XR37
Domain Number 1 Region: 47-122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000111
Family Growth factor receptor domain 0.0051
Further Details:      
 
Domain Number 2 Region: 111-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000282
Family Fibronectin type I module 0.077
Further Details:      
 
Domain Number 3 Region: 209-253
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000523
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060XR37
Sequence length 363
Comment (tr|A0A060XR37|A0A060XR37_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ82128.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00039940001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MSWLLKWILIAAGIQQAYSQTQNSTAMLPLAESTDLEPYNRTQYCHWPCECPLVPHSCPS
GVSLLMDGCDCCKACARQVGEECNEADTCDYHKGLYCDYSSDKPRYEKGVCAYMVGVGCE
HDGVIYRNGQSFKPSCKYQCLCVNGAIGCVSLCTDSQPPRVWCQNSRRVKIPGRCCEQWI
CDEPKKGRKTAPRHAVEALPVELKGQSRNCVIQTTSWSICSKTCGRGLSLRVSNANDRCE
MVKESRLCNIRPCEVDITKHIKPGKNCMNIYREEQPKNFTISGCVSKKSYRPKYCGVCVA
TDHRCCIPYKSKTIDVEFMCPNGAVFTWQVMWINACFCNLSCKNPNDIFAELENFYGYPE
IVN
Download sequence
Identical sequences A0A060XR37
XP_021415677.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]