SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060XYT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060XYT7
Domain Number 1 Region: 117-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-33
Family cAMP-binding domain 0.000000828
Further Details:      
 
Domain Number 2 Region: 246-370
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-32
Family cAMP-binding domain 0.000000588
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.49e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060XYT7
Sequence length 379
Comment (tr|A0A060XYT7|A0A060XYT7_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ84833.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00063830001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MASGSTSSEEERSLRECELYVQKHNIQQLLKDCIVQLCTSRPDRPMAFLREYFERLEKEE
AKQILNQQKASSRSDSRDEEVSPPMNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDY
KTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVTYIAGETVIMQGDEGDNFYVIDQGET
DVYVNNECVTSIGEGGSFGELALIYGTPRAATVRAKSNVKLWGIDRDSYRRILMGSTLRK
RKMYEEFLSKVSILESLDKWERLTVADSLEPVQFDDGQKIVVQGEPGDEFFIILEGSAAV
LQRRSENEEFVEVGRLQPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPC
SDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A060XYT7
XP_020315797.1.87700 XP_020315798.1.87700 XP_020315799.1.87700 XP_020315800.1.87700 XP_020315801.1.87700 XP_021431877.1.32639 XP_021431878.1.32639 XP_021431880.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]