SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Y6I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Y6I8
Domain Number 1 Region: 99-148
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000471
Family TSP-1 type 1 repeat 0.00049
Further Details:      
 
Domain Number 2 Region: 151-207
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000034
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060Y6I8
Sequence length 444
Comment (tr|A0A060Y6I8|A0A060Y6I8_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ87137.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00012914001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MPLVVKLLTPPPLALPHPSRQRPSSHSQPITSLHKTRGGGGGQQAPQTGKTTGRRGSPCI
TLYKSSFEASASERWAWGLPAEQQNSYSDAQLPAALIAVHGTWDEWSPWSLCSSTCGRGY
RDRTRSCKPPQFGGDPCMGPEKQTKFCNIAVCPVDGVWNEWANWGSCSASCSNGTMQRIR
ECNGPSYGGSECRGEWIETRDCFLRECPVEGKWHPWTSWVAAPRHKGVGTVQERETQCGF
TTYIQKPLVCPPKIKVCRRCQLLYWIQPHEICAEENFSNVVWKMTPAGDTAAVRCPPNAN
GLILRRCTLDDEGIAYWENPTYMKCISNDYRSIQTLTREHLSKAQRGLVGDGVSEVMTKL
RVTSSDGTSYSGDLLAIVDVLKNMTEIFRRAYNSPSNADMRNFVQSVSNLLMEENRERWE
EAQLVSWSLSLILTDSLALLYAHT
Download sequence
Identical sequences A0A060Y6I8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]