SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Y9P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Y9P3
Domain Number 1 Region: 491-543
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000222
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 2 Region: 255-312
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 3 Region: 432-488
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 313-369
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 5 Region: 373-426
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000484
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 195-252
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060Y9P3
Sequence length 594
Comment (tr|A0A060Y9P3|A0A060Y9P3_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ88658.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00010281001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MDKCGVCGGDNTACKLVSGLFQQHSLNKVGYHKIVEIPEGATKINVTETVKSRNYLALKS
RSGRSIINGNWAIDRPGEYEGVGTMFTYRRPNEVTSTAGESFLAEGPTNEILDVYVIYQQ
PNPGVSYEFILPSDNPPQHPDHRPGGNTLYGQSGNDHRGNPNQDGYDPAGGGKYPPQVPN
NQVPAVLPPRRQREYNWKLSGATECSASCGRGSRYTIFRCVHRLSHEQVPENQCDSSTRP
SSQEEPCNLQSCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRTLNVHTSRCRHLEQ
PETTSTCQLKICSEWQIQTEWSACYVPCGVGQRTREVHCVSNVGDFVSDEECNMKLRPSD
NENCDMGPCAKSWFFTEWGNKCSAECGMGVRTRGVLCLTNHISSLPLEGCGHERPTDSQV
CNHGPCESRIEWFTAPWSQCSTECGSGSQQRAVVCLMKSDEGFNVMPPYECSSLDKPLNQ
QSCHLKSCGAKWYHTDWSACSKTCEGGFRVREVRCLSDDMLSSERCEEELKPVEREECNP
EPCVPHIDENCRDKYFNCNVVVQARLCVYDYYKTTCCASCTRVAHRQSQHRALS
Download sequence
Identical sequences A0A060Y9P3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]