SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060YBH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060YBH3
Domain Number 1 Region: 15-82
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.53e-16
Family Poly(A) polymerase, PAP, N-terminal domain 0.0000738
Further Details:      
 
Domain Number 2 Region: 83-108
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000177
Family Poly(A) polymerase, PAP, middle domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060YBH3
Sequence length 144
Comment (tr|A0A060YBH3|A0A060YBH3_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ89278.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00004672001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MQTVHQLFFFPPPPQAVEEAFVPVIKLSFDSIEIDILFARLALQTIPENLDLRDDGLLKN
LDIRCIRSLNGCRVTDEILHLVPNIENFRLTLRTIKLWAKLHNIYSAIHLLXXVEPASLG
PWGNVEPASLGPWVMLNLPVWTPG
Download sequence
Identical sequences A0A060YBH3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]