SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060YC47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060YC47
Domain Number 1 Region: 67-112
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000876
Family F-box domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060YC47
Sequence length 166
Comment (tr|A0A060YC47|A0A060YC47_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ89266.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00009014001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MATRTICIVVFKVWRVSCPLRHEKPQPAENKKSHTDFLQDSHAQGSHIGRVFGPHTLDYV
VNLCWHRYDYLVRLPDWLLLNILSFLEWADIKNISQTCKRLQQLCCSERFWAQGTAGARY
GQSEVTMEGVSPTLQRRLVVFHRRQVLSRLAQQQQHSKRKNSVWHL
Download sequence
Identical sequences A0A060YC47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]