SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060YH23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060YH23
Domain Number 1 Region: 353-541
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.21e-66
Family Regulator of G-protein signaling, RGS 0.00000602
Further Details:      
 
Domain Number 2 Region: 748-976
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-62
Family DBL homology domain (DH-domain) 0.0000000112
Further Details:      
 
Domain Number 3 Region: 977-1112
Classification Level Classification E-value
Superfamily PH domain-like 6.84e-38
Family Pleckstrin-homology domain (PH domain) 0.00000725
Further Details:      
 
Domain Number 4 Region: 34-114
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-21
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060YH23
Sequence length 1441
Comment (tr|A0A060YH23|A0A060YH23_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ88714.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00014515001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MLCYSASPACVLVGQTFCDCVLAEGKPESCGLVQRCVIIQKDENGFGLTVSGDNPVFVQL
VKEDGAAERAGVQTGDRIIKVNGTLVTHSNHVEVVKLIKSGSYVALTVLGRPPGLPQIPL
LEGEAKVVFLGPQTGSSSVTSPNSPGQPMGEQPYSPHDRITSPLPIWEENNSVHNQKVHI
LQKMLSKEQEDLQAMKEEYSRNPTPKLLKDIQEAKKHIPQLQGQLSKATGGAQDALRLGD
GDDGSMVDMDHTPSSSSHELSWSSSMMSPVLRGFASASPESLCQRDLLSYHSPKSTPRDS
FNSCHSPDPEDTPDLDSLSPSTVSSPSRFVSQIIGAEDDYFDSDQEQVNGQCSCFQSMEL
LKSRPAHLAAFLHHVVSQFDPASLLCYLYADLCKQTNSKETRRVFMDFHNFFIDRGANLK
VAVPESLSSDLDRRRTELIPEELNRQYVQMVQDTQLPDIQRNLEDFRSKRSMGLTLAEGE
LARLDTERVRDRVALERERACAENIITKIEDVLLTTQSTEEEKCTTMQYVILTYMKHLGV
KVKEPRGLESKWVRINFLPKIKSIKTEKEGGEEKVKRTRFPSILGPPRRPSRVDPMSVGK
AMDLNKPRPQKQLSQPCLEHLEAGRLRASQSSEGSELIHSSPTNATSPTNNNSDGGSRDS
EFVGTPNSAFLKLSEGLGDLDSPEYTPNTHFDYSLSPYSLDQLQEEDRESGILEGTPKAI
RRLDGLGSTEVQSEDDQGGTDSEHDPLNWQQLVGREVLAGLQPHEIKRQEVINELFYTER
AHLRMLKVLDNIFYQKLTREGILPPADIKNIFTNLEDIVQLHVWISEQMVTIRKRNETSV
IDQIGDDLLSWFSRGEEEKIKQAVGTFCSNQPFALELIKSRQKKDSRFTSFMQEAESNRL
CRRLQLKDIIPVEMQRLTKYPLLLENIAKYTDDTVEKDKVKKAGDCCRNILNHVNQAVKE
SENKQRLEDYQRRLDLSSLKQTENPMISELKNLDLTKKKMVHEGPLSWKVNKDKTIELYT
LLLEDILVLLQKQDERLILKCHSKNLSGTADTKHIFSPIIKLNAVLVRSVATDNKSFFVL
SMSDNGAQIYELMAQTVSEQRMWQRQITQRADAMKVKPNSVIPLPQTDGERDGVEIITAG
IAQLSKDPDRISSGSNQSIDKEGCAASGGEMQTSLPDANPFEGLKPEEEEPNREEGLYRD
PDLADRLPFRMAVEGLSESDSVGFSPSRADDALKTLSALKQVLVTQLMSQEDGEGAGRSS
SGGGRLLRTTSLRTPVDSRARVADPAQDLVSGDTGFFESPEDYAGYLVLEGYGGSGESST
DDDLQATGKQLSASRGCGAGDSGISLRFSSASQAGSISSFSRQVLSHIRNLQTNLNHLKE
VEAKYHSLLRQRPARSSTDMDDNKGRFIHLTYTSRGQAFTIYQIDMGRTHPETCNDISVL
S
Download sequence
Identical sequences A0A060YH23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]