SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060YRZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060YRZ0
Domain Number 1 Region: 33-89
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000746
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 2 Region: 94-152
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000889
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060YRZ0
Sequence length 174
Comment (tr|A0A060YRZ0|A0A060YRZ0_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ94501.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00061415001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MYFSLSLPPQLIIQEHNQGVEYEYYLPNGRSREGYYWSFGSWSTCSRECGSGYQSRLVFC
AIDNEAYPDYLCTALPRPLTNRTCNPQTCPQTRRWTTGEWNACSVSCGGGSQVRSVQCVS
HDASGPRVVEDGACAAYTPAPPTLQTCSMQLCASWRASAWSLVGTEAEQQSDGG
Download sequence
Identical sequences A0A060YRZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]