SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060YTA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060YTA6
Domain Number 1 Region: 68-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.06e-16
Family TSP-1 type 1 repeat 0.0000875
Further Details:      
 
Domain Number 2 Region: 122-180
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.76e-16
Family TSP-1 type 1 repeat 0.0000871
Further Details:      
 
Domain Number 3 Region: 13-62
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000432
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 325-385
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000051
Family TSP type-3 repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 181-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060YTA6
Sequence length 438
Comment (tr|A0A060YTA6|A0A060YTA6_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ92365.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00012133001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MSVCLSVLSDYAEDGWSLWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSVQTRDCYLQ
ECDKRFRQDGAWSHWSPWSSCSVTCGAGVITRIRLCNSPTPQLGGKDCQGEGRQTEKCTK
SPCPVNGNWGPWSLWDTCSSTCGGGAQTRKRLCNDPAPKYGGKECQGDSKATQLCNRNAC
PVDGCLSNPCFPGTKCTSVPDGTWNCGKCPTGYSGDGIKCEDIDECKEVPDACFVFNGVH
RCENTDPGYNCLPCPARYSGPQPFGRGVEEATAKKQVCTPRNPCLDGSHDCNKNARCNYL
GHFADPMYRCECKPGYAGNGHICGEDTDLDGWPNQDLVCVENATYHCKKDNCPNLPNSGQ
EDYDMDGVGDACDNDDDNDGIPDDRVSEELIIDSLIEGLKSYPLLREMNPGYATSLGSQC
VCVCVCVCVCVCVCVCVC
Download sequence
Identical sequences A0A060YTA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]