SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060YUY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060YUY5
Domain Number 1 Region: 14-69
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000456
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060YUY5
Sequence length 72
Comment (tr|A0A060YUY5|A0A060YUY5_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ95397.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00049328001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
LFLSLSFSLALFLSSQVNLDSKTRDLTTQLLQAPSHTSLSHAQKRIYSLLDTDCYPRFLQ
STIYLTLLGQAD
Download sequence
Identical sequences A0A060YUY5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]