SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060YYG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060YYG4
Domain Number 1 Region: 36-92
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000432
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 92-147
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 3 Region: 147-202
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000275
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 246-299
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060YYG4
Sequence length 299
Comment (tr|A0A060YYG4|A0A060YYG4_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ96761.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00051061001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MGLRSRERYVKQFPDDGSVCTLPTEENEKCIVNEECTPNSCLVTEWGEWDSCSATCGLGM
KRRERMVKMPPPDGSICGAEVLEVEKCMMPECHTIPCMLSPWSDWSDCSVTCGKGMRTRQ
RVLKSPVELGECIEDLDQVEKCMLPECPTDCMVSEWTEWSECNKSCGKGHMIRTRIVKLE
PQFGGDSCPETVQRKKCKIRKCNRDDGQGQVNSDEKKRRKEAREKRRSKQGGPQGEETMS
PAEHPGCKMRPWSSWTDCTKLCGGGIQERLMTAKKRLKSAQLPSCKDRKEIRACNVYPC
Download sequence
Identical sequences A0A060YYG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]