SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Z4H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Z4H9
Domain Number 1 Region: 81-140
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000000004
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060Z4H9
Sequence length 160
Comment (tr|A0A060Z4H9|A0A060Z4H9_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ98926.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00039500001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MGILIKYLTHTQQRKQPTLLTGCTTSNHNTSPPYSQIKEFSISRLHDFSLTYMEDGCVHW
GYYPVSKDSSSPPETIFREGKAPLVFQSAVSPPSVGLLWVEMLRFYSLEFNMTECVISVR
TSLVVSRDAKDWPKKRIAVEGVSVDEDKAGNHSVMLIEFE
Download sequence
Identical sequences A0A060Z4H9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]