SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Z4U6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Z4U6
Domain Number 1 Region: 135-274
Classification Level Classification E-value
Superfamily C-type lectin-like 8.4e-30
Family C-type lectin domain 0.0005
Further Details:      
 
Domain Number 2 Region: 4-120
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-27
Family C-type lectin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060Z4U6
Sequence length 285
Comment (tr|A0A060Z4U6|A0A060Z4U6_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ96305.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00027516001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MGEEQVTFEEGRKACAGSGATLITIANRFEQAFVNSLVFGRSGDSFWIALLDQNSPGKFH
WLSGDEVTYTNWNRDQPGGNIKGGCVTMETGYATGLWEVKDCASARAKFICRLNQDTSLS
PEPPAPHPTPSLTGSCPNGWKTNDKLHHCYKVFDRAQMDQKLSWLQAHLACQRHHGANLL
SVSGPEEEHFILQILHEAFGESEDHEQHWFWIGLNRRNPMDNGSWKWSDGLAYTYQNFGR
YYYNVRQCAAADLGSMTWLAMLCEAKLDWICKIPKGNSKTRAHRH
Download sequence
Identical sequences A0A060Z4U6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]