SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Z5J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Z5J2
Domain Number 1 Region: 11-111
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.46e-20
Family Synaptotagmin-like (S variant) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060Z5J2
Sequence length 117
Comment (tr|A0A060Z5J2|A0A060Z5J2_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ96999.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00044638001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MSLADQSQQWYPTSVQVTVFQARNLRIKGKNGTNDAYAIMQVAKDKFSTSVAEKCVAPVW
KEEATFDLPLFHHGNAERCTLYIIVMHRALVGLDKLLGRAVINLLDLHDNSARKKTE
Download sequence
Identical sequences A0A060Z5J2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]