SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Z5Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Z5Z5
Domain Number 1 Region: 26-80
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000994
Family TNF receptor-like 0.001
Further Details:      
 
Domain Number 2 Region: 80-159
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000262
Family TNF receptor-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060Z5Z5
Sequence length 246
Comment (tr|A0A060Z5Z5|A0A060Z5Z5_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ99528.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00000915001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MAQCESFIWTIPIILVLVSIGSCIACGRAEYRIRDECCPMCSPGNHVHKHCTEFTSTSCV
PCVDSTFLDEPNGLIKCKVCTNCDPGLGLKVKQPCRLSSDTVCGTLEGFYCLDPTKDGCR
APQRHSSCKPGQYISHTGTTSTDTVCSDCTGDTYSNGSLTACQSHTGCESLGLQEIKPGS
PWSDSECGPQLSHSTARSRIGAVASMTVVMILAAAVSLLLIIVRRNVCILSVSIASVNYC
FVCVRE
Download sequence
Identical sequences A0A060Z5Z5
XP_021472562.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]