SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Z6A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Z6A7
Domain Number 1 Region: 35-90
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000144
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060Z6A7
Sequence length 187
Comment (tr|A0A060Z6A7|A0A060Z6A7_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ99628.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00015460001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MVKIIPSYSFFPSLVLSQHCFKGHCIWLTIDMIKQDGGWDMWSQFGSCTRTCGGGVQFRT
RECKNPRPANGGRTCLGTNHQFQLCNSQECEELYSDFREEQCRSLDPVFEFHNNKHHWLP
YEHTEPKQRCHLHCQSTETRDKIDMLRLVQDGTRCSYKDPYSVCVSGECEVSVCVHKYSS
VFVVKYK
Download sequence
Identical sequences A0A060Z6A7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]