SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Z6T1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Z6T1
Domain Number 1 Region: 71-189
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-29
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00045
Further Details:      
 
Domain Number 2 Region: 13-68
Classification Level Classification E-value
Superfamily LCCL domain 0.000000000000314
Family LCCL domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060Z6T1
Sequence length 210
Comment (tr|A0A060Z6T1|A0A060Z6T1_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ97015.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00053886001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MDHNQYLLPLPQSSPVCLAAIHAGVVSNSVGGQISVVNSKGIPHYDGSLANNVSSTVGPL
SNSLFTFKTSGCYGTLGLESGVVRDSQLFASSVWEWSDVIGKPSEWGPTGARLNGAGLPW
ASAHSNQQQWLQVDLKKEKRITGITTTGSSLLEYQFYVSAYRVLYSNDGQHWNIYREADA
TQDKVMKISLSSITLKVLNSHFEKYFFPHG
Download sequence
Identical sequences A0A060Z6T1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]