SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Z7Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Z7Y3
Domain Number 1 Region: 133-197
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000425
Family Protein kinases, catalytic subunit 0.004
Further Details:      
 
Domain Number 2 Region: 36-93
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000981
Family Regulator of G-protein signaling, RGS 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060Z7Y3
Sequence length 219
Comment (tr|A0A060Z7Y3|A0A060Z7Y3_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDR00183.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00063599001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MDMGGLQNIVANSAYVSARGSVDGMAASTMRDKKFRAKLNLPHIKKSEHMKTTVNSGFDS
MCVKQPIGKRLFQQYLERDATHKNACNLWKDIEISTSPRRSTGCRRPRRSSTSSTNSSPR
SFAASWRRRLLKKHKGYEGAIVEKRILAKVHSRFIVSLVYAFQTKTNLCLVMPIMNGGDL
RYCYTHTKTHAGLIHTQTCTHTHTRMHAKKTTHTHTHTR
Download sequence
Identical sequences A0A060Z7Y3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]