SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Z8V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Z8V4
Domain Number 1 Region: 45-103
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000419
Family Pointed domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060Z8V4
Sequence length 125
Comment (tr|A0A060Z8V4|A0A060Z8V4_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ97710.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00001125001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
RKSNMEEVQDELMHRLTLGRSANKKFAVPARSTSLPSVNITYDSSPDEVKAWLQLKGFSS
VTITSLGVLTGAQLFSLNKEELKTVCPDDGARVFSQVTVQKAALEVGSASPLTKPDNTEP
ANPAS
Download sequence
Identical sequences A0A060Z8V4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]