SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060ZVU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060ZVU4
Domain Number 1 Region: 160-298
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.89e-16
Family SMI1/KNR4-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060ZVU4
Sequence length 325
Comment (tr|A0A060ZVU4|A0A060ZVU4_9ACTN) Cell wall assembly/cell proliferationcoordinating protein, KNR4-like protein {ECO:0000313|EMBL:CDR07274.1} OX=576784 OS=Streptomyces iranensis. GN=SIRAN4017 OC=Streptomyces.
Sequence
MTTGRLGQHAAPPNTAYAGQVVHFPDPVRAARHPKGVRVDENGFPDFSPYARAAAEIAEP
PEGFGVDELRLTDYVSANAALHATGHELWNEASAVATPHGWTWHHVVGTRRMELIPVEVK
ALLRHHGGLATAQVDQEKRGTRPLQETRPMHVGLPLRGISVTEEQVLGVEEDLGYRLPDS
YRAFLKAAGGCAPVGTALDPELGLLIDQPFFTVRDEAAVNDLVYVNKCLRDHFTKDYLGV
GFVQGGVIAVKVKGDAIGSVWFCAYDDARDRDGWTVQERVERLLLPCGDDFDAFLLRLAG
NPPELETVANLMVDGGFAYAVPVEG
Download sequence
Identical sequences A0A060ZVU4
WP_044570903.1.55263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]