SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061A5R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061A5R2
Domain Number 1 Region: 32-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000314
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061A5R2
Sequence length 229
Comment (tr|A0A061A5R2|A0A061A5R2_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:CDR18155.1} OX=576784 OS=Streptomyces iranensis. GN=SIRAN53 OC=Streptomyces.
Sequence
MVVVVPAVADRVFSMGDDTHRVVAAWGRIETWLREHAAASAGLLRPPAGEADIAAAEVAI
GVEFPASLAAWYGVHDGFDEGHGAGILPSGMTMLPLADVVDEYRMRTRDWEREAGILPFA
RTAGDTWSGWYVDARRGEPSYGDLGHWSVDGGDDLYPLGQGGWPLVDWLEEIAAALQEGR
CLHRPDGMDGRHDWPVLTGSQGLTWIDPRDPRLFPDGMIKLGGTAAGVR
Download sequence
Identical sequences A0A061A5R2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]