SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061A968 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061A968
Domain Number 1 Region: 242-293
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 0.00000106
Family Rap/Ran-GAP 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061A968
Sequence length 293
Comment (tr|A0A061A968|A0A061A968_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDR19153.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00047381001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
TYGTTYVRTYVRTYVRTYVRTYVRTYVRTYYVLRTRTSTSYVLYVYSYSYSYYSTLSLSL
SLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSFSLSLSLSLSLSLSLSQGNRMEE
QRCTFPPPLKTEEDYIPYPSVHETQLQCSHFTSNMDLGYLCFMVDISEFIRNHYHTAWAK
SPQPLCAHLHVANQVLERKSGFPLILLPQFGGYWIEGNNHELSDSTDPDQIQPLSPTTRN
KLESNSTAKIYRKHFLGKEHFNYYSVDGALGHLVFSLKYDEIGDQEHLRLMLR
Download sequence
Identical sequences A0A061A968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]